Anti-SARS-CoV-2 ORF8 Antibody

Boster Bio Anti-SARS-CoV-2 ORF8 Antibody catalog # A33995. Tested in ELISA applications. This antibody reacts with Human.

Product Info Summary

SKU: A33995
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: ELISA

Customers Who Bought This Also Bought

Product Name

Anti-SARS-CoV-2 ORF8 Antibody

View all Antibodies

SKU/Catalog Number

A33995

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SARS-CoV-2 ORF8 Antibody catalog # A33995. Tested in ELISA applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SARS-CoV-2 ORF8 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A33995)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Clonality

Polyclonal

Clone Number

IC-16

Isotype

Rabbit IgG

Immunogen

AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Reactive Species

A33995 is reactive to in Human

Applications

A33995 is guaranteed for ELISA Boster Guarantee

Observed Molecular Weight

140 kDa, 130 kDa, 110 kDa

Calculated molecular weight

16693 MW

Background of

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF8 encodes a viral accessory protein.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

ELISA, 0.001-0.1μg/ml, Human

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Hello CJ!

No publications found for A33995

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SARS-CoV-2 ORF8 Antibody?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-SARS-CoV-2 ORF8 Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-SARS-CoV-2 ORF8 Antibody

Order DetailsPrice
A33995

100μg

$415
A33995-10ug

10μg sample (liquid)

$99
A33995-Biotin

100 μg Biotin conjugated

$615
A33995-Cy3

100 μg Cy3 conjugated

$615
A33995-Dylight488

100 μg Dylight488 conjugated

$615
A33995-Dylight550

100 μg Dylight550 conjugated

$615
A33995-Dylight594

100 μg Dylight594 conjugated

$615
A33995-FITC

100 μg FITC conjugated

$615
A33995-HRP

100 μg HRP conjugated

$615
A33995-APC

100 μg APC conjugated

$715
A33995-PE

100 μg PE conjugated

$715
A33995-carrier-free

Carrier Free

$415

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A33995
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$415.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.